View primary antibody

Basic data

PIDumg-sfb1190-antibody-primary-1032
EPIC PIDhttps://hdl.handle.net/21.11124/umg-sfb1190-antibody-primary-1032
Research group-
Quality (mean)no score (0.00)
Sharing levelPublic

Antibody data

Antigen symbolCDH2
Antibody Registry ID(s)AB_2683760
NameAnti-CDH2 Antibody
Alternative name
Lab ID
Tag / Fluorophore
Raised inrabbit
Reacts withhuman
Clone
IsotypeIgG
Clonalitypolyclonal
Demaskingunknown
AntigenRecombinant Protein Epitope Signature Tag (PrEST) antigen sequence, NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP
Crafted Bycompany
Company / ManufacturerAtlas Antibodies
Catalog no.HPA058574
Lot no.
Descriptionhttp://www.uniprot.org/uniprot/P19022
Localization
Storage instructionStore at +4°C for short term storage. Long time storage is recommended at -20°C.
Receipt date2020-01-01 00:00:00
Preparation date2020-02-13 00:00:00
Created byAdministrator, Administrator
Last modifiedAdministrator, Administrator

External links

Applications


No application comments yet.

Linked publications


There are no linked publications.