Technical Support: sfb1190-support@gwdg.de
Department of Medical Informatics
University Medical Center Göttingen
SFB 1190 - Imprint
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
![]() | umg-sfb1190-antibody-primary-1050 | TUBA1C | AB_887860 | α-Tubulin | polyclonal | - | Synaptic Systems | 302 203 | |
![]() | umg-sfb1190-antibody-primary-1049 | GFAP | AB_10001722 | GFAP Antibody | polyclonal | Recombinant full length human GFAP isotype 1 expressed in and purified from E. coli | - | Novus Biologicals | NB300-141 |
![]() | umg-sfb1190-antibody-primary-1048 | GOLGA2 | AB_10015242 | Purified Mouse Anti-GM130 | monoclonal | Rat GM130 aa. 869-982 | - | BD Transduction Laboratories | 610822 |
![]() | umg-sfb1190-antibody-primary-1047 | CLTA | AB_887705 | Clathrin light chain | monoclonal | Synthetic peptide corresponding to AA 156 to 173 from rat Clathrin light chainB (UniProt Id: P08082) | - | Synaptic Systems | 113 001 |
![]() | umg-sfb1190-antibody-primary-1046 | SYN1 | Synapsin | unknown | - | Reinhard Jahn, Max-Planck-Institut für Biophysikalische Chemie | |||
![]() | umg-sfb1190-antibody-primary-1045 | RIMS1 | AB_887774 | RIM 1 | polyclonal | Recombinant protein corresponding to AA 596 to 705 from rat Rim1 (UniProt Id: Q9JIR4) | - | Synaptic Systems | 140 003 |
![]() | umg-sfb1190-antibody-primary-1044 | RAB3GAP1 | AB_397762 | Purified Mouse Anti-Rab3 | monoclonal | Rat Rab3A aa. 60-220 | - | BD Transduction Laboratories | 610379 |
![]() | umg-sfb1190-antibody-primary-1043 | SLC17A7 | AB_2285905 | VGLUT 1/2 | polyclonal | Synthetic peptide corresponding to AA 324 to 339 from rat VGLUT1 (UniProt Id: Q62634) | - | Synaptic Systems | 135 503 |
![]() | umg-sfb1190-antibody-primary-1042 | SYP | AB_887824 | Synaptophysin 1 | monoclonal | Recombinant protein corresponding to AA 1 to 307 from rat Synaptophysin1 (UniProt Id: P07825) | - | Synaptic Systems | 101 011 |
![]() | umg-sfb1190-antibody-primary-1041 | SYT1 | AB_887832 | Synaptotagmin 1 cytoplasmic tail | monoclonal | Recombinant protein corresponding to AA 80 to 421 from rat Synaptotagmin1 (UniProt Id: P21707) | - | Synaptic Systems | 105 011 |
![]() | umg-sfb1190-antibody-primary-1040 | VAMP2 | AB_887811 | Synaptobrevin 2 | monoclonal | Synthetic peptide corresponding to AA 2 to 17 from rat Synaptobrevin2 (UniProt Id: P63045) | - | Synaptic Systems | 104 211 |
![]() | umg-sfb1190-antibody-primary-1039 | AB_305426 | Anti-BrdU antibody [BU1/75 (ICR1)] | monoclonal | The details of the immunogen for this antibody are not available. | - | Abcam | ab6326 | |
![]() | umg-sfb1190-antibody-primary-1038 | RASAL1 | AB_1948369 | RASAL Antibody | polyclonal | The immunogen for this antibody is: C-QERGKAALGPLGP | - | ProSci | 46–269 |
![]() | umg-sfb1190-antibody-primary-1037 | HDAC2 | AB_2118543 | Anti-HDAC2 antibody | polyclonal | Synthetic peptide corresponding to Human HDAC2 aa 450 to the C-terminus (internal sequence) conjugated to keyhole limpet haemocyanin. (Peptide available as ab16200, https://www.abcam.com/ab16200.html) | - | Abcam | ab16032 |
![]() | umg-sfb1190-antibody-primary-1036 | DNMT1 | AB_2537688 | DNMT1 Monoclonal Antibody (60B1220.1) | monoclonal | Synthetic peptide corresponding to amino acids 637-650 (EKDDREDKENAFKR) of human Dnmt1. | - | ThermoFisher Scientific | MA5-16169 |
![]() | umg-sfb1190-antibody-primary-1035 | DNMT1 | p-DNMT1 | unknown | - | Bioss | ZYE1107W | ||
![]() | umg-sfb1190-antibody-primary-1033 | MKI67 | AB_10979488 | Ki-67 Monoclonal Antibody (SP6) | monoclonal | A synthetic peptide derived from the human Ki-67 protein | - | ThermoFisher Scientific | MA5-14520 |
![]() | umg-sfb1190-antibody-primary-1032 | CDH2 | AB_2683760 | Anti-CDH2 Antibody | polyclonal | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence, NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP | - | Atlas Antibodies | HPA058574 |
![]() | umg-sfb1190-antibody-primary-1031 | MYOM1 | AB_10696312 | MYOM1-Specific Antibody | polyclonal | myomesin 1, GenBank accession number: NM_003803 | - | Proteintech | 20360-1-AP |
![]() | umg-sfb1190-antibody-primary-1030 | MYL2 | AB_887737 | MLC-2A | monoclonal | Recombinant protein corresponding to AA 1 to 175 from human MLC-2A (UniProt Id: Q01449, http://www.uniprot.org/uniprot/Q01449) | - | Synaptic Systems | 311 011 |
![]() | umg-sfb1190-antibody-primary-1029 | MYL2 | AB_10645889 | MLC-2V | polyclonal | Synthetic peptide corresponding to AA 104 to 118 from mouse MLC-2V (UniProt Id: P51667, http://www.uniprot.org/uniprot/P51667) | - | Synaptic Systems | 310003 |
![]() | umg-sfb1190-antibody-primary-1028 | TNNT1 | AB_956386 | Anti-Cardiac Troponin T antibody | polyclonal | Synthetic peptide conjugated to KLH derived from within residues 50 - 150 of Human cardiac Troponin T. Read Abcam's proprietary immunogen policy (Peptide available as ab47005. https://www.abcam.com/ab47005.) | - | Abcam | ab45932 |
![]() | umg-sfb1190-antibody-primary-1027 | MYH7 | AB_528385 | Human β Myosin heavy chain | monoclonal | - | Developmental Studies Hybridoma Bank | A4.951 | |
![]() | umg-sfb1190-antibody-primary-1026 | ITGB1 | AB_2128061 | Anti-Integrin β1 Antibody, a.a. 82-87, clone JB1A (a.k.a. J10) | monoclonal | Purified beta 1 integrin and Jurkat cells | - | Millipore | MAB1965 |
![]() | umg-sfb1190-antibody-primary-1025 | PECAM1 | AB_726362 | Anti-CD31 antibody | polyclonal | Synthetic peptide within Mouse CD31 aa 700 to the C-terminus (C terminal). The exact sequence is proprietary. Database link: Q08481, http://www.uniprot.org/uniprot/Q08481 | - | Abcam | ab28364 |